<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
421376 421376 Thailand 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S24N, D25E, V31I, V32I, S39C, I60M, I72V, I84M, F100Y, L101I, T112V, T125A, D167E, K173R, K188R, V201I, I203M, T206S, K215N, T218L, L234I, I268L, R269K, D278A K14KIRT, S283G
>421376| codons 1-288
FLDGIDKAQEEHETYHSNWRAMANEFNLPPIIAKEIVACCDKCQLKGEAMHGQVDCSPGM
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLRTAVQMAV
FIHNFKRRGGIGGYSAGERIIDMIASDIQTKELQNQILKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKILKDYGKQMAGADCVAGRQDED

References
Author Title Citation
Wilantho A HIV-1 integrase isolated from infected patients in Thailand. GenBank Submission, 2011