<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1601 CA23779 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDC+ AZT 17
2 IDV+ D4T+ 3TC 87
3 EFV+ DDI+ ADV 35
4 ABC+ D4T+ RTV+ IDV 83

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, K20I, N37D, K55R, I62V, L63P, C67CF, A71T, I72IMT, V77I, I93L  
>CA23779| codons 1-98
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIRVRQYD
QVPIEIFGHKTTSTVLIGPTPVNVIGRNLMTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R     V35M, T39A, K43Q, E44D, R83RK, V118I, K122E, G196E, T200TA, E203ED, Q207E, R211K, A272P, K281R, E297R A299AG
>CA23778| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIDELREHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTREGE
L

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005