<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9710 CA23776 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+D4T+EFV+LPV 9
3 None 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215L G190A   V35E, T39A, K101S, K122KE, I135K, V179VI, Y181X, R211K, I244IV, V245VA, A272P, T286A  
>CA23776| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLSKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
XQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFLTPDKKHQKEPPFLWMGYELHPDKWT
VQPVALPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, T12E, K20I, E35D, M36MI, I62IV, L63P, K70R, A71IV, V77I, I93IL  
>CA23777| codons 1-99
PQITLWQRPIVEIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHRIISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005