<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7115 CA23768 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+EFV+IDV+LPV 53

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215F   G190A, M230L V108I, F227L K43N, K49R, V60I, R83K, V90I, V118I, S162D, K166R, T200A, A272P, E297KR, Q334H, G335S, G359S, A371IV, A376AT, V381I, T386TS, A400T, T403M, D460N, Q487E, L491S, S519N, K530KR  
>CA23768| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISRIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRAKIEELRQHLWRWGFFTPDKKHQKEPPLLWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHSQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKITTESIIIWGKSPKFKLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIHLALEDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82VA, L90M G73S K20I, M36I, N37S, R41K, I62V, L63P, A71V, I72R, V77VI  
>CA23769| codons 12-99
TIKIGGQLIEALLDTGADDTVLEEISLPGKWKPKIIGGIGGFVKVRQYDQVPIEICGHKV
RSTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005