<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6359 CA23766 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 31
2 3TC+D4T+NVP 96
3 3TC+ABC+NVP 119

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67NS, K70R, L74LV, M184V K219Q K101KE, G190A K238KT K20R, E28EK, K32T, T39A, V60I, T69N, K173R, Q174K, N175Y, G196E, R211S, F214L, D218E, T286A, V292I, I293V, E297KR K263KQ
>CA23766| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTKEKITALVEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKYPDIVI
YQYVDDLYVASDLEIEQHRTKIEELRQHLLSWGLTTPEQKHQKEPPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGQLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, I62V, L63P, A71V, V77I, I93L  
>CA23767| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    I72IV, L101I, K111R, T124TA, T218I, A265AV R284RG
>CA125434| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVRTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASGQDED

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005