<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1502 CA23764 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV 35
2 3TC+D4T+NFV 178

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q   V108I K20R, V35M, V60I, K64KR, T69TN, K101RS, K122P, I135T, K166Q, D177E, I178L, D218DE, A272P, K277R, T286TA, I293IV  
>CA23764| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIRKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTILDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTQILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10IV, L19I, N37ND, R41K, L63P, A71V, T74TS, I93IL  
>CA23765| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMDLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005