<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9705 CA23759 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 52
2 NRTI+SQV 52
3 NFV+NRTI 52
4 3TC+D4T+IDV 52
5 3TC+D4T+DLV+IDV 57
6 3TC+ABC+DDI+IDV+RTV 83
7 3TC+ABC+APV+DDI+RTV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, Q18H, L19T, E35D, L63P, A71V, I72L, I85V, I93L  
>CA23759| codons 1-98
PQITLWQRPIVTIKIGGHTKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVLSTVLVGPTPVNVVGRNLMTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   K20R, K43KE, I142V, S162C, T200A, L228H, Q242QH, A272G, R284RK, T286A, E297KR  
>CA23758| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLKGAKALTEVIPLTREA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005