<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, K14R, P30AS, S39C, I60M, I72V, T112A, I113V, T124A, T125A, V126F, K136Q, D167EK, V201I, I203M, I220V, D232DN, L234I S283G
>KSH24INT| codons 1-288
FLDGIEKAQEEHERYHSNWRAMASDFNLPSVVAKEIVACCDKCQLKGEAMHGQVDCSPGM
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKAVHTDNGSN
FTSAAFKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRKQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQKQITKVQNFRVYYRDSRNPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TP, I13V, L19Q, K20R, E35D, M36I, R41K, R57K, I62V, H69K, L89M  
>KSH24PRRT| codons 1-99
PQITLWQRPLVPVKIGGQQREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V21VI, V35IT, V60I, D121Y, K122E, I135T, Q174QH, D177EK, V179I, T200I, Q207AD, R211K  
>KSH24PRRT| codons 1-240
PISPIDTVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPKIII
YQYMDDLYVGSDLEIGQHRIKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Jahanbakhsh, F Prevalence of transmitted HIV drug resistance in Iran between 2010 and 2011. PLoS ONE, 2012