<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PT_15 PT_15_BL Italy 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, T124A, T125A, K156N, F181L, K211R, S230N, D256E, D279G  
>PT_15_BL| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRKGGIGGYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDGCVASRQDED

References
Author Title Citation
Armenia, D Study of genotypic and phenotypic HIV-1 dynamics of integrase mutations during raltegravir treatment: A refined analysis by ultra-deep 454 pyrosequencing. J Infect Dis, 2012