<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PT_5 PT_5_BL Italy 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  G163K S17N, R20K, E96D, L101I, S119T, T124A, T125A, K156N, V201I, K211KR, T218I, L234V, D256E  
>PT_5_BL| codons 1-272
FLDGIDKAQEEHEKYHNNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQDTAYFILKLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIKQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYG

References
Author Title Citation
Armenia, D Study of genotypic and phenotypic HIV-1 dynamics of integrase mutations during raltegravir treatment: A refined analysis by ultra-deep 454 pyrosequencing. J Infect Dis, 2012