<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PT_69 PT_69_MO_5 Italy 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 RAL NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H E92EA D25E, L28I, S39C, L101I, V165I, K215N, Q216H A8P
>PT_69_MO_5| codons 1-288
FLDGIDKPQEEHEKYHSNWRAMASEFNIPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAATGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMHKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQNHITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Armenia, D Study of genotypic and phenotypic HIV-1 dynamics of integrase mutations during raltegravir treatment: A refined analysis by ultra-deep 454 pyrosequencing. J Infect Dis, 2012