<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9699 CA23740 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V K219Q K103N   K11KR, K20R, V35I, V60I, I135T, S162A, K166R, R172RK, Q207E, R211K, K277R, I293V  
>CA23740| codons 1-299
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTRILEPFKKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I15V, E35D, M36MIV, Q61E, L63P  
>CA23741| codons 1-98
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDVNLPGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLN

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009