<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9694 CA23726 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 126
2 3TC+AZT+IDV 52
3 3TC+D4T+IDV 48
4 3TC+D4T+RTV+SQV 190

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SG, V75M, L210W, T215CY       V35E, T39A, S68N, K122E, R211K, I293V, K331KN, Q334N, G335S, A360AT, K366R, T369V, A371V, I375V, A376T, T377L, A400T, E404D, V435A, K451R, D460N, R461K, V466A, S468P, Q480H, H483L, A554S, V559I  
>CA23726| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPV
FAIKKKDNSKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQNQGNSQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVRQLVEVVQKVTLESIVIWGKTPKFKLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETRLGKAGYVTNKGRQKAVPLTDTTNQKTELH
AILLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, L63T, I72IV, V77I  
>CA23727| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005