<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I15V, L19I, M36I, R41K, L63H, H69K, L89M, I93L  
>LC017I| codons 1-99
PQITLWQRPLVSIRVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, V60I, V111I, K122E, I135V, E138S, S162C, V179I, T200A, Q207E, R211K, V245Q  
>LC017I| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSVNNSTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTV

References
Author Title Citation
Han, X High prevalence of HIV-1 intersubtype BC recombinants among injecting drug users in Dehong, China. PLoS ONE, 2013