<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4461 CA23714 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 69
2 AZT+DDI 92
3 3TC+AZT+IDV 130
4 D4T+DDI+EFV 98

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y A62AV L100LI, K103N   T39A, E44D, A98S, K101X, D123E, I178L, E203K, Q207E, H208Y, R211K, K223KE, L228R, I293V, M357T, R358RK, E370DN, T386I, A400L, K451R, L452LS, D460N, R461K, L491S, E529D, V559VI  
>CA23714| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FVIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGIXKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDKKHQEEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTNAVQKIATESIVIWGKIPKFKLPIQKETWELWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETRSGKAGYVTNKGRQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKDKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, E35D, K45KR, L63S, I64V, E65D  
>CA23715| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPRMIGGIGGFIKVRQYD
QISVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, E11D, E13ED, S17N, I72V, I113V, S119P, T124N, T125V, I220L, D253E  
>CA124160| codons 1-288
FLDGIEKAQEDHDKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGPN
FTSNVVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKLQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQENSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005