<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5280 CA23708 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 62
2 AZT+ 3TC 22
3 3TC+AZT+IDV 145
4 D4T+DDI+NFV 13
5 3TC+D4T+DDI+NFV 2
6 3TC+D4T+NFV 15
7 NVP+RTV+SQV 30
8 3TC+APV+AZT+RTV 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V, T215F   Y188L   K122E, A158S, E169D, G196D, Q207K, V245E  
>CA23708| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILDPFRKQNPDIVI
YQYVDDLLVGSDLEIDQHRTKIEELRKHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, I84V, L90M L33F, N88D I15V, R41K, K45R, R57K, L63P, A71V, V82VI, I85V, I93L  
>CA23709| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVFEEMNLPGKWKPRMIGGIGGFLKVKQYD
QIPIEICGHKVIGTVLVGPTPINVVGRDLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005