<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1166 CA23703 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 DDC 21
3 D4T 21
4 3TC+ AZT 35
5 AZT+ D4T 17
6 AZT+ D4T+ IDV 13
7 3TC+ D4T+ IDV 47
8 3TC+ D4T+ NFV 31
9 SQV+ RTV+ D4T+ 3TC 9
10 None 55
11 RTV+ IDV+ EFV+ DDI 19
12 IDV+ EFV+ DDI 63
13 LPV+ EFV+ DDI 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15L, L19I, K20R, R41K, L63A, A71V, I93L  
>CA23703| codons 1-99
PQITLWQRPLVTIKLGGQIREALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35M, K122E, I135T, T200I, I202V, V245M, A272P, I293V, E297D  
>CA23702| codons 1-301
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTDEAE
L

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005