<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, L19I, L63A, I93L  
>BRGO4167| codons 1-99
PQITLWQRPLVPIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E40A, D121H, K122E, D123E, I135T, S162C, D177E, T200A, F214L  
>BRGO4167| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTAMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Alcantara, KC Increasing heterosexual transmission of HIV-1 subtype C in inland central western Brazil. J Med Virol, 2013