<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9684 CA23695 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 52
2 D4T 52
3 3TC+D4T+IDV 100
4 NVP+RTV+SQV 176

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V, L90M   L10R, I13V, N37S, D60DE, I62V, L63P, I64V, V77I  
>CA23695| codons 1-98
PQITLWQRPRVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKLIGGIGGFIKVRQYE
QVPVEICGHKAIGTVLIGPTPVNVIGRNLMTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   K103N   I135T, I167V, R211K, K277R, T286A, E297A I270T
>CA23694| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQTYAGIKVRQLCKLLRGAKALTEVIPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009