<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRGO4043 BRGO4043 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+NRTI+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, M184V, T215Y   L100I   V35T, S68G, K122E, D123E, I135T, V179I, I202V, K219X, H221Y  
>BRGO4043| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFYTPDXKYQKEPPFLWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M N88D P39S, K45R, R57K, I62V, L63P, A71T, V77I, I93L  
>BRGO4043| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLSGRWKPRMIGGIGGFIKVKQYD
QVPIEICGHKTIGTVLIGPTPVNIIGRDLMTQLGCTLNF

References
Author Title Citation
Alcantara, KC Increasing heterosexual transmission of HIV-1 subtype C in inland central western Brazil. J Med Virol, 2013
Lima, YA HIV-1 infection and pregnancy in young women in Brazil: socioeconomic and drug resistance profiles in a cross-sectional study. BMJ Open, 2016