<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3894 CA23686 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI 110
2 DDI+IDV+RTV 19
3 3TC+APV+D4T 35
4 3TC+D4T+LPV 9
5 3TC+D4T+DLV+SQV 16
6 3TC+D4T+LPV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, L33I, Q58QE, G73S K20R, E35D, M36I, I62V, L63P, I66V, A71V, V82I, Q92K, I93L, C95F  
>CA23686| codons 1-99
PQITLWQRPFVTIKIGGQLREALLDTGADDTVIEDINLPGRWKPKMIGGIGGFVKVREYD
QVPIEVCGHKVISTVLVGPTPINVIGRNLMTKLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, F77L, F116Y     K20R, S68G, T69N, K122E, D123A, I202V, Q207A, R211K, F214L, V245Q, A272P, R284K, I293V  
>CA23685| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDGNKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEAFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005