<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1415 CA23683 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 83
2 AZT+DDI 30
3 DDC 91
4 3TC+AZT 52
5 3TC+AZT+IDV 83
6 D4T+NFV+NVP 26
7 D4T+DDI+NFV+SQV 61
8 3TC+ABC+D4T 126

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210SW, T215Y K219Q K101KE, Y181YC, G190A   K20R, V35T, T39A, E44ED, V60I, V118VI, K122E, K166R, E203EK, Q207E, H208HY, D218DE, L228H, Q242QH, A272P, T286TA, I293V, E297T  
>CA23683| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIKELREYLSRWGFYTPEQKHQKEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTTEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63PS, I72IT  
>CA23684| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005