<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5058 CA23682 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+DDC 47
3 3TC+D4T 65
4 3TC+D4T+NFV 91
5 3TC+D4T+IDV 30
6 3TC+D4T+RTV+SQV 21
7 3TC+EFV+IDV 88

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10I, E35D, L63S, I64V, A71V, I72V, I93L  
>CA23682| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QISVEICGHKVVTTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K101P, K103S   T39A, R83K, K102KR, D123DE, S162F, V179I, E204Q, R211K, H221HY, D250E, A272P, T286A, A288P, E297R  
>CA23681| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLPRSKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEQLRQHLLKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKPLTEVIPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005