<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   E6D, K11T, V35T, T39K, T69N, V111I, K122E, D123S, I135T, K173I, Q174K, D177E, T200I, Q207A, R211S, F214L, V245E  
>XCP49| codons 1-255
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, L19IM, E35D, M36I, R41K, K43R, H69K, V82VI, L89M  
>XCP49| codons 1-99
PQITLWQRPLVPIKIGGQMKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Wu, J New emerging recombinant HIV-1 strains and close transmission linkage of HIV-1 strains in the Chinese MSM population indicate a new epidemic risk. PLoS ONE, 2013