<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2308 CA23673 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 17
2 3TC+AZT+IDV 104
3 D4T+DDI+NFV 57
4 ABC+APV+DDI+RTV+SQV 42
5 3TC+D4T+DDI+EFV 81

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, M184V, L210LW, T215Y V75VL K101E, G190S   K20R, K43KE, K49KR, V60I, V118VI, I135T, T139TR, Q207QH, P294Q  
>CA23673| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISRIGPENPYNTPI
FAIKKKNSTKWRKVLDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRTKIEELRHHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIQLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V L10F, K43T, G73S, L89V T12E, I13V, K14KM, G16E, M36L, R41R_R, L63H  
>CA23674| codons 1-99
PQITLWQRPFVEVMIEGQLKEALLDTGADDTVLEELNLPGRWTPKIIGGIGGFVKVRQYD
QIHIEICGHKAISTVLVGPTPANVIGRNVLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005