<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5349 CA23672 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 96
2 Unknown 226
3 3TC+D4T+IDV 61
4 3TC+D4T+NFV 105
5 ABC+D4T+EFV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   K20I, N37T, K55R, I62V, L63P, I64V, T74S, I93L  
>CA23672| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMTLPGRWKPKIIGGIGGFIRVRQYD
QVPVEICGHKAIGSVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V T215I, K219Q K103N, M230L   K20R, A98S, Q197E, Q207E, R211K, F214L, V245K, D250E, T286A, I293V, D324E, I329L, M357V, T369I, A376C, K390R, T403I, E404D, V435I, E449D, L452S, K512R  
>CA23671| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGEHRTKIEELREHLLKWGLITPDQKHQKEPPFLWLGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAELQKQGQGQWTYQIYQEPFKNLKTGKYARVRGA
HTNDVKQLIEAVQKICTESIVIWGKTPKFRLPIQKETWEAWWIDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRDTKSGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDRSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005