<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7066 CA23665 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 29
2 3TC+AZT 13
3 3TC+AZT+IDV 22
4 DDI+NFV+NVP 20
5 RTV+SQV 48
6 ABC+D4T+EFV 142

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215F   K103N, Y181C V179F T7X, K20KR, K43KE, K49KR, K82R, A98S, D177E, G196E, E203X, Q207K, R211A, H221HY, L228LR, A272P, I293V  
>CA23665| codons 1-301
PISPIEXVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNRRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIFI
CQYMDDLYVGSDLEIEQHRTKIXELRKHLWAWGFFTPDKKYQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R57K, I62V, L63P, A71V, I72V, V75VI, V77I, I93L  
>CA23666| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKVVGTILIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005