<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5242 CA23663 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 None 104
3 IDV+ D4T+ 3TC 104
4 None 20
5 DDI+ D4T+ NFV 138

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y, N348I   V179D V35IL, S68SG, T69TA, V118I, K122E, I135T, I142V, R172RK, T200A, F214L, K277R, I293IV, I326T, R356K, T386I, G436E, V466A, T477A, E492A, K527N, A554S  
>CA23663| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIDI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLTAEIQKQGQGQWTYQIYQEPFKILKTGKYAKMRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVEAETFYVDGAANRETKLGKAGYVTDRGRQKAVSLTDTTNQKAELQ
AIHLALQDSGLAVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90LM L10FI I13V, K14KR, K20KM, M36I, I62V, L63P, I64IV, A71V, I93L  
>CA23664| codons 1-99
PQITLWQRPFVTVRIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYD
QVPVEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005