<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I15IL, K20KM, E35D, M36I, N37NDGS, R57K, L63AITV, I64V, E65D, L89LM G40G*, R41KQ
>S114DB| codons 1-99
PQITLWQRPLVTIKLGGQLMEALLDTGADDTVIEDISLP*QWKPKMIGGIGGFIKVKQYD
QIVVDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D A98S, I135T, S162C, T200A, Q207G, F214L  
>S114DB| codons 30-240
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPSGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQCSMTKILEPFRKQNPDIDIYQYMDDLYVGSDLEIGQHRAKIEELRGHL
LRWGLTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Akrim, M HIV-1 subtype distribution in Morocco based on national sentinel surveillance data 2004-2005. AIDS Res Ther, 2012