<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4080-L631 4080-L631 Argentina 2008 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I15V, G17D, K20T, E35D, M36I, R57K, Q61N, L63V, T74S  
>4080-L631| codons 8-99
RPLVTIKVGDQLTEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVKQYDNIVIEIC
GHKAIGSVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35I, K49R, R83K, K122E, I135L, K173R  
>4080-L631| codons 1-212
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRW

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011