<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA798 CA23644 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 291
2 AZT+DDC+SQV 26
3 None 65
4 3TC+AZT+IDV 105
5 ADV+DDI+EFV 29
6 DDI+EFV 3
7 None 17
8 ABC+ADV+IDV+RTV 10
9 3TC+ADV+D4T+IDV+RTV 5
10 3TC+D4T+IDV+RTV 8
11 None 28
12 D4T+DDI+LPV 42
13 None 13
14 3TC+DDI+RTV+SQV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M G73C L10I, I15V, G16E, K20M, E35D, M36I, R57K, Q61N, L63C, T74S, I85V, I93L  
>CA23644| codons 1-99
PQITLWQRPIVTIKVEGQLMEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYD
NICIEICGHKAICSVLVGPTPANIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   L100LI, K103KN   V21VI, K43E, K82KR, V118VI, K122E, D177E, T200A, R211K, A272P, T286A, I293V  
>CA23643| codons 1-304
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNRRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005