<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7-K475 7-K475 Argentina 2006 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74I, Y115F, M184V V75T     V35I, T39A, V60I, K64H, K122E, D123N, I135L, E138A, T200A  
>7-K475| codons 1-212
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPI
FAIHKKNSDRWRKITDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSVPL
DENFRKYTAFTIPSLNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82S L24I, K43T L10I, I15V, L19I, K20R, E35D, M36I, K55R, Q61N, L63P, T74S, Q92K  
>7-K475| codons 8-99
RPIVTIKVGGQIREALIDTGADDTVLEDINLPGRWTPKIIGGIGGFVRVRQYDNIPIEIC
GHKAIGSVLVGPTPSNIIGRNLLTKIGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011