<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4460-L674 4460-L674 Argentina 2008 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74I, M184V V75T Y181C, G190A K101H, V108I K20R, V35M, T39S, K122E, D123N, I135L, Q174R, D177E, V179I, T200A, Q207E  
>4460-L674| codons 1-212
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICSELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKITDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEIII
CQYVDDLYVASDLEIGQHRAKIEELREHLLRW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L24I, K43T L10I, T12P, I15V, G16E, L19P, K20R, E35D, M36I, N37D, K55R, R57K, D60E, Q61D, A71V, I72R, I93L  
>4460-L674| codons 8-99
RPIVPIKVEGQPREALIDTGADDTVLEDIDLPGRWTPKIIGGIGGFVRVKQYEDILIEIC
GHKVRGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011