<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3307-G71 3307-G71 Argentina 2003 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63T, E65D, P79S, I93L  
>3307-G71| codons 8-99
RPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNITIDIC
GHKAIGTVLVGSTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35I, G45E, V60I, D123E, D177E, I178L  
>3307-G71| codons 1-212
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICTEMEKEEKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRW

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011