<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6866 CA23634 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 5
2 DDI 119
3 AZT+ DDI 50
4 DDI+ 3TC+ IDV 112
5 Unknown 141

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T, L90M   I62V, L63P, I93L  
>CA23634| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPTNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184MV A62AV K103N V108I A33AV, K122E, I135IT, K166R, F214L, K223KT, L228LR, A272P, K277R, K281R, T286A, A288AS, I293IV, E297AP  
>CA23633| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKVLVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQTEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGAKSLTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005