<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
352-O64MD 352-O64MD Argentina 2008 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, T215Y   L100I, K103N   V35K, V118I, K122E, D123E, E204D  
>352-O64MD| codons 1-228
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEDLRQHLLRWGFYTPDKKHQKEPPFL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D T12K, I13V, I15V, E35D, M36I, N37D, R41K, R57K, Q61N, A71T, I72T, V75I  
>352-O64MD| codons 1-99
PQITLWQRPLVKVKVGGQLKEALLDTGADNTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKTTGTILVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011