<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1015-O234HMN 1015-O234HMN Argentina 2008 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215F K219Q Y181V   K20R, V35I, V60I, K101Q, D123E, F171Y, D177E, V189I, F214FL  
>1015-O234HMN| codons 1-227
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPEIVI
VQYVDDLYIGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10I, L19I, N37T, R57K, Q61D, A71V, I93L  
>1015-O234HMN| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMTLPGRWKPKMIGGIGGFVKVKQYD
DILIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011