<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3214-N808CMN 3214-N808CMN Argentina 2008 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A V108I V35T, K49R, V60I, K103R, D123E, E138A, E169D, D177E, I180V, T200A  
>3214-N808CMN| codons 1-212
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKRKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVV
YQYVDDLYVASDLEIGQHRAKIEELRQHLLRW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, Q61D, I72T  
>3214-N808CMN| codons 8-99
RPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDDILIEIC
GHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011