<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
96-N422ELE 96-N422ELE Argentina 2008 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12D, I15V, L19I, K20R, M36I, R41K, K55R, R57K, Q61D, I72T, L89I  
>96-N422ELE| codons 1-99
PQITLWQRPLVDIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIRVKQYD
DILIEICGHKATGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N   K20R, V35T, E44D, V60I, A98S, K101Q, I135M, S162A, D177N, I178M, G196E, R211K F61Y
>96-N422ELE| codons 1-221
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKDGKISKIGPENPYNTPI
YAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPSGLQKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPNMVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKH

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011