<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4396-L592FMC 4396-L592FMC Argentina 2006 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V D67G K101P, K103S, G190A   E28K, K32E, V60I, S68G, K122E, D123E, I135T, I142T, V179I, T200I  
>4396-L592FMC| codons 1-208
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLPKSKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVASDLEIGQHRIKIEELRQH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   L10I, I15L, L19V, K20R, E35D, M36I, R41K, K55R, R57K, Q61N, I62V, L63S  
>4396-L592FMC| codons 1-99
PQITLWQRPIVTIKLGGQVREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVRVKQYD
NVSIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011