<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2133-L458JCD 2133-L458JCD Argentina 2006 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, T215I, K219Q     V35T, T69N, D121H, K122E, I135M, S162H, K166R, V179I H198A, P226H
>2133-L458JCD| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQHSMTRILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQARTKIEELRQHLLRWGFITPDQKHQKEPHFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, T12E, I15V, K20I, E35N, M36I, R41K, R57K, D60E, Q61N, I62V, L63P, A71T  
>2133-L458JCD| codons 1-99
PQITLWQRPIVEIKVGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFVKVKQYE
NVPIEICGHKTIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011