<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3006-M668AS 3006-M668AS Argentina 2007 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   K103N   V35I, V60I, A98S, V118I, D123E, I135T, I142V, F214L  
>3006-M668AS| codons 1-227
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDKKHQKEPPF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   T12Q, K14R, I15V, M36I, R41K, K43R, Q61N, L63P, I72V, Q92T  
>3006-M668AS| codons 1-99
PQITLWQRPLVQIRVGGQLKEALLDTGADDTVLEEINLPGKWRPKLIGGIGGFIKVRQYD
NIPIEICGHKAVGTVLVGPTPVNIIGRNLLTTIGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011