<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
444-O288CCR 444-O288CCR Argentina 2008 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, I13V, I15V, K20T, E35N, M36I, R41K, Q61N, L63P, I72T, V77I, I93L T74M
>444-O288CCR| codons 8-99
RPIVTVKVGGQLTEALLDTGADNTVLENINLPGKWKPKMIGGIGGFIKVRQYDNIPIEIC
GHKATGMVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, Q151M, M184V V75T     V35T, T39A, A62P, S68G, K122E, D123N, I135V, I142V, R172K, D177E, I178L  
>444-O288CCR| codons 1-212
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPV
FPIKKKDGTKWRKITDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRW

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011