<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
59-O184CME 59-O184CME Argentina 2008 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V   Y181C   T7A, V35T, T39S, S68G, S134SC, T139R, S162C, V179I, T200A, R211K  
>59-O184CME| codons 1-212
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALTEICSELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPCINNERPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
CQYVDDLYVGSDLEIGQHRAKIEELRQHLLKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20M, E35D, M36I, R41K, R57K, Q61D, A71T, I72T, I93L  
>59-O184CME| codons 8-99
RPLVTIKVGGQLMEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDDILIEIC
GHKTTGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Aulicino, PC Longitudinal analysis of HIV-1 BF1 recombinant strains in vertically infected children from Argentina reveals a decrease in CRF12_BF pol gene mosaic patterns and high diversity of BF unique recombinant forms. Infect Genet Evol, 2011