<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9668 CA23621 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NFV 4
2 3TC+DDC 4
3 None 148
4 3TC+ABC+AZT+EFV 10
5 3TC+ABC+D4T+EFV 15

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H V35I, R83K, I178L, T200I, R211G, V241VM, A272P  
>CA23621| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLGWGFTTPDKKHQKEHPFLWMGYELHPDKWT
MQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37S, P39Q, R41K, L63P, A71V, I93L  
>CA23622| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLQGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005