<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5027 CA23611 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+D4T+IDV 57
3 D4T+DDI+NFV 43
4 D4T+DDC+RTV+SQV 39
5 None 17
6 3TC+D4T+EFV 65
7 3TC+D4T+NVP 15

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103KN, Y181C   V35T, D123E, I135T, Q174R, D177E, T200A, Q207E, R211K  
>CA23611| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L63P, V77I, T96S  
>CA23612| codons 12-98
TVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKA
IGTVLIGPTPVNIIGRNLLTQIGCSLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005