<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V31I, I72V, L74I, I89L, T112V, I113V, S119P, T124N, T125A, G134N, K136Q, M154I, D167E, V201I, L234I, S255N  
>CY255| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVLPAETGQETAYFLLKLAGRWPVKVVHTDNGPN
FTSNAVKAACWWANIQQEFGIPYNPQSQGVVESINKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, I15IV, E35D, M36I, R41K, L63LP, H69K, L89M, I93L  
>CY255| codons 1-99
PQITLWQRPLVTVRVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, E36D, T39M, K122E, D123S, I135T, S162SN, K173A, Q174RS, D177E, T200I, Q207A, R211S, V245E, E248D, D250DGNS, A272P, V276I, K277R, T286A, E291D, V292I, I293V, P294T, D324E, I326V, G335D, R356K, M357R, R358G, G359S, E370A, A371V, I375V, A376T, T377M, K390R, T403M, V435A, L452A, S468P, D471E, Q480H, L491S, K512R, L517I, S519N, Q520K, Q524K, K527E, K530R, A534S, A554Q  
>CY255| codons 1-560
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTDICMEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRASNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKSSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKELVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRGSA
HTNDVKQLTAVVQKVTMESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKAGKAGYVTDRGRQKVVPLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNKIIEKLIEKERVYLSWVPAHK
GIGGNEQVDKLVSQGIRKVL

References
Author Title Citation
Kousiappa, I Molecular characterization of HIV type 1 strains from newly diagnosed patients in Cyprus (2007-2009) recovers multiple clades including unique recombinant strains and lack of transmitted drug resistance. ARHR, 2011