<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CY222 CY222 Cyprus 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12V, I13V, I15V, E35D, M36I, R41K, K43R, R57K, L63T, E65D, I72T, L89M  
>CY222| codons 1-99
PQITLWQRPVVVVKVGGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD
QITIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kousiappa, I Molecular characterization of HIV type 1 strains from newly diagnosed patients in Cyprus (2007-2009) recovers multiple clades including unique recombinant strains and lack of transmitted drug resistance. ARHR, 2011