<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA624 CA23587 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 209
2 3TC+D4T 117
3 3TC+AZT+NFV 31
4 3TC+D4T+RTV+SQV 27
5 3TC+D4T+EFV+SQV+Unknown 34
6 3TC+D4T+EFV+RTV+SQV 26
7 Unknown 17
8 3TC+ABC+D4T+EFV 49
9 3TC+ABC+D4T+NVP 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, Y115F, Q151M, M184V A62V, V75I, F77L, F116Y Y181C V108VI, K238KT S68G, T69K, K166R, D177E, Q207E, R211K, H221Y, L228H, K277R, I293V  
>CA23587| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDGKGWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAFYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKYQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37NS, L63P  
>CA23588| codons 1-98
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLN

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005