<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5106 CA23585 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 69
2 3TC+AZT+NFV 74
3 D4T+IDV+NVP 30
4 DDC+EFV+RTV 129

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215Y   L100I, K103N   M16MV, K122E, I135T, T139TA, K173KR, I178L, R211K, A272P, I293V, E297A  
>CA23585| codons 1-301
PISPIETVPVKLKPGVDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M N88D T12K, I13V, K20T, E35D, M36I, R41K, I62V, L63H, A71V, V77VI, I93L, C95F  
>CA23586| codons 1-99
PQITLWQRPLVKVKIGGQLTEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QVHIEICGHKVIGTVLIGPTPVNIIGRDLMTQLGFTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009